A practical reference on GHRH analog: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
This page was last updated on 2026-02-04 and is reviewed periodically as new material appears.
CJC-1295 is a synthetic analogue of growth hormone-releasing hormone, built on the 29-amino-acid GHRH(1-29) fragment. Four substitutions distinguish it from the natural sequence: D-alanine at position 2, glutamine at position 8, alanine at position 15, and leucine at position 27. These changes reduce enzymatic cleavage and extend the peptide's persistence in circulation. The compound is discussed in two forms, one carrying a drug affinity complex and one without it.
The drug affinity complex is a maleimidopropionic acid group attached to a lysine side chain. It reacts with the free thiol of cysteine-34 on circulating albumin, forming a covalent bond. This conjugation keeps the peptide in the bloodstream and shields it from rapid renal filtration and proteolysis. Reported circulation half-lives for the albumin-bound form fall in the range of roughly six to nine days in early human studies.
Binding to GHRH receptors on pituitary somatotroph cells triggers cyclic AMP signaling and stimulates growth hormone synthesis and release. Because the peptide acts upstream of the pituitary, effects are mediated through endogenous growth hormone rather than direct receptor activation in peripheral tissues. Increases in insulin-like growth factor 1 are generally described as a downstream consequence. Most published human exposure data come from small early-stage studies, and the clinical significance of the pharmacokinetic profile remains incompletely characterized.
Stability depends heavily on physical state. A lyophilized powder kept dry, desiccated, and shielded from light typically holds its integrity for months to years at minus twenty degrees Celsius, and longer at minus eighty. Once dissolved, the peptide becomes far more vulnerable, since peptide bond hydrolysis, oxidation of susceptible residues, and aggregation all proceed faster in solution. Buffers near neutral pH are generally gentler than strongly acidic or alkaline conditions. Repeated freeze-thaw cycles and exposure to air-liquid interfaces during vigorous mixing cause losses that are easy to overlook.
Verification matters because research peptides vary widely in quality. A certificate of analysis is only as reliable as the method behind it, and a single chromatographic trace reveals little about counter-ions, residual solvents, or water content. Independent laboratories commonly pair mass confirmation with chromatographic purity and, where relevant, quantify water along with acetate or trifluoroacetate content. Reported purity figures are not standardized across suppliers, so a stated value such as ninety-eight percent is not directly comparable unless the analytical method, column, and detection wavelength accompany it.
| Property | Value | Notes |
|---|---|---|
| Physical form | Lyophilized white powder | Supplied as a freeze-dried solid for research use |
| Molecular weight | Approximately 3,647 Da (DAC form) | Lower for the variant lacking the albumin-binding moiety |
| Solubility | Soluble in water and aqueous buffer | Typically dissolved in sterile or bacteriostatic water |
| Typical storage temperature | −20 °C or below | Dry powder, desiccated and protected from light |
| Common analytical method | Reversed-phase HPLC with mass spectrometry | Used for purity estimation and identity confirmation |
At the pituitary, the peptide binds the growth hormone-releasing hormone receptor on somatotroph cells. Receptor activation raises intracellular cyclic AMP and triggers release of stored growth hormone. Somatostatin and other hypothalamic signals modulate this response. Negative feedback from insulin-like growth factor 1 also influences output. The same regulatory architecture operates with the native hormone. Whether the synthetic analog alters feedback dynamics over repeated exposure remains an open question. Most published receptor work uses cell models rather than intact human systems.
CJC-1295 is a synthetic peptide belonging to the growth hormone-releasing hormone analog family. It comprises twenty-nine amino acid residues derived from the N-terminal region of natural GHRH. The molecule incorporates several non-natural substitutions that increase resistance to enzymatic degradation. These modifications extend its activity compared with the native hormone fragment. Researchers use it to study pituitary growth hormone secretion in laboratory and clinical settings. This compound is distinct from native GHRH in its stability profile.
Two principal forms appear in the literature and in research supply. One carries a drug affinity complex, a maleimide-based group that forms a covalent bond with circulating albumin. This linkage slows clearance and produces a long-lasting elevation of peptide levels. The other form lacks that group and is often labeled MOD GRF(1-29). It has a much shorter circulation time. Both variants retain the same core receptor-binding sequence. Reported half-lives differ substantially between the two.
The peptide binds GHRH receptors on somatotroph cells within the anterior pituitary, triggering a signalling cascade that increases growth hormone secretion. Its improved resistance to dipeptidyl peptidase IV degradation distinguishes it from the parent hormone. In the DAC-bearing version, a maleimide group reacts with a cysteine residue on serum albumin, forming a covalent bond that keeps the peptide in circulation far longer. That albumin attachment is the central design feature separating the two research variants.
Pharmacokinetic behaviour differs sharply between the two forms. The DAC-bearing peptide shows an extended circulation time measured in days, whereas the version without the complex is cleared within roughly half an hour. This gap shapes how researchers design dosing schedules in animal models. Whether the prolonged presence of the DAC form produces effects meaningfully different from the short-acting variant remains an open question, since comparative human data are scarce.
Downstream of growth hormone, the liver and other tissues increase production of insulin-like growth factor 1, a mediator of many growth-promoting effects. Studies have documented elevated levels of both hormones after dosing, and the rise from the long-acting form persists longer than that produced by shorter-acting analogues. What remains unclear is whether sustained elevation of these markers translates into meaningful clinical benefit, and whether prolonged exposure carries risks that short trials could not detect.
CJC-1295 acts at the growth hormone-releasing hormone receptor, a G-protein-coupled receptor found on somatotroph cells in the anterior pituitary. Binding triggers a rise in cyclic AMP and calcium entry, which promotes release of stored growth hormone. Because the peptide mimics the body's own releasing hormone, it amplifies existing secretory pulses rather than driving continuous output. The size of the response therefore depends partly on the subject's own hormonal rhythm and feedback state.
== Taxonomic range == In many small organisms such as bacteria, quorum sensing enables individuals to begin an activity only when the population is sufficiently large. This signaling between cells was first observed in the marine bacterium Aliivibrio fischeri, which produces light when the population is dense enough. The mechanism involves the production and detection of a signaling molecule, and the regulation of gene transcription in response. Quorum sensing operates in both gram-positive and gram-negative bacteria, and both within and between species. In slime molds, individual cells aggregate together to form fruiting bodies and eventually spores, under the influence of a chemical signal, known as an acrasin. The individuals move by chemotaxis, i.e. they are attracted by the chemical gradient. Some species use cyclic AMP as the signal; others such as Polysphondylium violaceum use a dipeptide known as glorin. In plants and animals, signaling between cells occurs either through release into the extracellular space, divided in paracrine signaling (over short distances) and endocrine signaling (over long distances), or by direct contact, known as juxtacrine signaling such as notch signaling. Autocrine signaling is a special case of paracrine signaling where the secreting cell has the ability to respond to the secreted signaling molecule. Synaptic signaling is a special case of paracrine signaling (for chemical synapses) or juxtacrine signaling (for electrical synapses) between neurons and target cells.
=== Mike: Creatine Rage === First Aired: 16 December 2010 Meet Mike, the shortest bully to appear on the show. He stands at 5'4 and is a Bronx gym rat who makes life miserable for his victims, Lorenzo and Joey. Mayhem Miller brings in MMA fighter Eddie Alvarez with a record of 22 wins and 2 losses to teach him a lesson. In the first round, Mike tapped out five times. In the second round, he got K.O'd. Mike is the first bully to get K.O.'d without getting 1 punch thrown at him. Lorenzo and Joey won $10,000.
=== Etymology and terminology === The origin of the term dry needling is attributed to Janet G. Travell. In her 1983 book, Myofascial Pain and Dysfunction: Trigger Point Manual, Travell uses the term dry needling to differentiate between two hypodermic needle techniques when performing trigger point therapy. However, Travell did not elaborate on the details of the dry needling techniques: the injection of a local anesthetic and the mechanical use of a hypodermic needle without injecting a solution. The current techniques were based on traditional and Western medical acupuncture.
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
Sources: en.wikipedia.org
== In popular culture == The Gulf War has been the subject of several video games including Conflict: Desert Storm, Conflict: Desert Storm II, Gulf War: Operation Desert Hammer, and Call of Duty: Black Ops 6, which was banned in Kuwait. Depictions in film include Jarhead (2005), which is based on US Marine Anthony Swofford's 2003 memoir of the same name. The 2016 Bollywood movie Airlift is based on the 1990 airlift of stranded Indian citizens from Kuwait during the Gulf War. As for music, Gil Scott-Heron's song "Work for Peace" from the 1994 album Spirits was a response to the war. Additionally, the 2002 audio documentary The Fire This Time features contemporaneous interviews and media selections set to electronic music by various artists.
=== Fl–Fu === Louis B. Flexner (1902–1996). American biochemist at the University of Pennsylvania, who worked on the biochemistry of memory and brain function. Member Natl. Acad. Sci. USA. Otto Folin (1867–1934). Swedish-American chemist at Harvard, best known for developing methods for the determination of the constituents of protein-free blood filtrates. Member Natl. Acad. Sci. USA. Karl August Folkers (1906–1997). American biochemist at Merck, known for work on the antibiotics cathomycin and cycloserine. Ivar Asbjørn Følling (1888–1973). Norwegian biochemist and geneticist who first described phenylketonuria. Sidney W. Fox (1912–1998). American biochemist at the University of Miami who worked on the production of amino acids in abiotic conditions. Heinz Fraenkel-Conrat (1910–1999). German-American biochemist at UC Berkeley, known for research on viruses such as tobacco mosaic virus. Member Natl. Acad. Sci. USA. Rosalind Franklin (1920–1958). British X-ray crystallographer at King's and Birkbeck Colleges, London, who worked on the structure of DNA Perry A. Frey (b. 1935). American biochemist at the University of Wisconsin known for work on enzyme mechanisms. Member Natl. Acad. Sci. USA. Irwin Fridovich (1929–2019). American biochemist at Duke University, who discovered superoxide dismutase and studied its mechanisms and superoxide toxicity. Member Natl. Acad. Sci. USA. Joseph S. Fruton (1912–2007). Polish-American biochemist at the Rockefeller Institute.
Coordinates were measured in grades on official French terrestrial ordnance charts from the French revolution well into the 20th century. 1 grade (or in modern symbology, 1 gon) = 0.9° or 0.01 right angle. One advantage of this measure is that the distance between latitude lines 0.01 gon apart at the equator is almost exactly 1 kilometre. It would be exactly 1 km if the original definition of 1 metre = 1⁄10,000 quarter-meridian had been adhered to. One disadvantage is that common angles like 30° and 60° are expressed by fractional values (33+1⁄3 and 66+2⁄3 respectively) so this "decimal" unit failed to displace the "sexagesimal" units equilateral-vertex – degree – minute – second invented by Babylonian astronomers.
=== PCR-based methods === Tetra-primer amplification refractory mutation system PCR, or ARMS-PCR, employs two pairs of primers to amplify two alleles in one PCR reaction. The primers are designed such that the two primer pairs overlap at a SNP location but each match perfectly to only one of the possible SNPs. The basis of the invention is that unexpectedly, oligonucleotides with a mismatched 3'-residue will not function as primers in the PCR under appropriate conditions. As a result, if a given allele is present in the PCR reaction, the primer pair specific to that allele will produce product but not to the alternative allele with a different SNP. The two primer pairs are also designed such that their PCR products are of a significantly different length allowing for easily distinguishable bands by gel electrophoresis or melt temperature analysis. In examining the results, if a genomic sample is homozygous, then the PCR products that result will be from the primer that matches the SNP location and the outer opposite-strand primer, as well from the two outer primers. If the genomic sample is heterozygous, then products will result from the primer of each allele and their respective outer primer counterparts as well as the outer primers. An alternative strategy is to run multiple qPCR reactions with different primer sets that target each allele separately. Well-designed primers will amplify their target SNP at a much earlier cycle than the other SNPs. This allows more than two alleles to be distinguished, although an individual qPCR reaction is required for each SNP.
He declined to travel to El Salvador to see Abrego Garcia, but said that his office was "looking at all available options to ensure that due process is going to be followed by El Salvador". In February 2026, after it was reported that the U.S. Department of Homeland Security had purchased a warehouse in Washington County with plans to renovate it into an immigration detention facility, Moore ordered state agency heads and the attorney general of Maryland to review the federal government's purchase of the facility. He also wrote to Homeland Security Secretary Kristi Noem expressing concerns about the economic impacts the facility would have on the local area as well as the "troubling lack of transparency" around the purchase. That same month, he signed into law a bill to prohibit counties from entering into 287(g) program agreements with U.S. Immigration and Customs Enforcement (ICE). In May 2026, Moore signed into law a bill that prohibits law enforcement officers from wearing face coverings with exceptions for officers involved in undercover operations. In April 2026, Moore signed into law the Maryland Values Act of 2026, which prohibits public school employees from assisting with immigration enforcement and requires public school employees to alert their local superintendents of immigration enforcement activities at schools.
Sources: en.wikipedia.org
The two share the same 29-amino-acid backbone. CJC-1295 carries an additional albumin-binding moiety that markedly extends its residence time in circulation, while the form without that moiety clears faster. Literature sometimes applies the name loosely to either variant.
It has not been approved by major regulatory agencies for any therapeutic indication. Material sold under this name is typically distributed for laboratory research only. Clinical use is not supported by large controlled trials.
Early human studies of the albumin-binding form reported circulation half-lives on the order of several days. The value depends on assay method and study design. Estimates for the form without the binding moiety are considerably shorter.
Mass spectrometry establishes whether the observed molecular weight matches the calculated sequence mass. Chromatographic retention and fragment mapping add further confidence about sequence and composition. A single technique alone is rarely treated as sufficient evidence of identity.